Essential Cookie Notice

1. What Are Cookies and Local Storage?

Cookies and browser local storage (`localStorage`) are small data keys preserved by your browser to retain technical state across page visits, such as navigation preferences or acknowledgement prompts.

2. How We Use Storage

scenesafariviewstick.christmas does not operate advertising networks, third-party marketing pixels, or commercial surveillance cookies. The only storage keys employed on this domain are strictly functional:

• UI & Session State: Remembering dismissals of technical prompts across pages.
• Local Draft Caching: Permitting your browser to hold text within the suggestion drafting tool until you choose to download or clear it.

3. Controlling Cookies in Your Browser

You can adjust your web browser settings to block, delete, or inspect cookies and storage items at any time. Because this website does not rely on user logins or external authentication services, disabling cookies will not affect your ability to read our guides, inspect our watchlists, or copy suggestion drafts.

4. Technical Contact

For technical inquiries regarding our implementation of browser storage standards, please write to [email protected].